APOH monoclonal antibody (M01A), clone 3F10 View larger

APOH monoclonal antibody (M01A), clone 3F10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of APOH monoclonal antibody (M01A), clone 3F10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about APOH monoclonal antibody (M01A), clone 3F10

Brand: Abnova
Reference: H00000350-M01A
Product name: APOH monoclonal antibody (M01A), clone 3F10
Product description: Mouse monoclonal antibody raised against a partial recombinant APOH.
Clone: 3F10
Isotype: IgM Kappa
Gene id: 350
Gene name: APOH
Gene alias: B2G1|BG
Gene description: apolipoprotein H (beta-2-glycoprotein I)
Genbank accession: NM_000042
Immunogen: APOH (NP_000033, 236 a.a. ~ 345 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC
Protein accession: NP_000033
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000350-M01A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000350-M01A-1-2-1.jpg
Application image note: APOH monoclonal antibody (M01A), clone 3F10 Western Blot analysis of APOH expression in HL-60 ( Cat # L014V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy APOH monoclonal antibody (M01A), clone 3F10 now

Add to cart