Brand: | Abnova |
Reference: | H00000345-M06 |
Product name: | APOC3 monoclonal antibody (M06), clone 8H7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant APOC3. |
Clone: | 8H7 |
Isotype: | IgG2a Kappa |
Gene id: | 345 |
Gene name: | APOC3 |
Gene alias: | APOCIII|MGC150353 |
Gene description: | apolipoprotein C-III |
Genbank accession: | NM_000040 |
Immunogen: | APOC3 (NP_000031.1, 21 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA |
Protein accession: | NP_000031.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (34.43 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged APOC3 is 0.3 ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |