APOC2 monoclonal antibody (M01), clone 3E4 View larger

APOC2 monoclonal antibody (M01), clone 3E4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of APOC2 monoclonal antibody (M01), clone 3E4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about APOC2 monoclonal antibody (M01), clone 3E4

Brand: Abnova
Reference: H00000344-M01
Product name: APOC2 monoclonal antibody (M01), clone 3E4
Product description: Mouse monoclonal antibody raised against a partial recombinant APOC2.
Clone: 3E4
Isotype: IgG2a Kappa
Gene id: 344
Gene name: APOC2
Gene alias: MGC75082
Gene description: apolipoprotein C-II
Genbank accession: BC005348
Immunogen: APOC2 (AAH05348, 23 a.a. ~ 101 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TQQPQQDEMPSPTLLTQVKESLSSYWESAKTAAQNLYEKTYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLKGEE
Protein accession: AAH05348
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000344-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (34.43 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy APOC2 monoclonal antibody (M01), clone 3E4 now

Add to cart