APOA2 monoclonal antibody (M03), clone 1H6 View larger

APOA2 monoclonal antibody (M03), clone 1H6

H00000336-M03_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of APOA2 monoclonal antibody (M03), clone 1H6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,IF,S-ELISA,ELISA,WB-Re

More info about APOA2 monoclonal antibody (M03), clone 1H6

Brand: Abnova
Reference: H00000336-M03
Product name: APOA2 monoclonal antibody (M03), clone 1H6
Product description: Mouse monoclonal antibody raised against a full-length recombinant APOA2.
Clone: 1H6
Isotype: IgG1 Kappa
Gene id: 336
Gene name: APOA2
Gene alias: -
Gene description: apolipoprotein A-II
Genbank accession: BC005282
Immunogen: APOA2 (AAH05282, 1 a.a. ~ 100 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ
Protein accession: AAH05282
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000336-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000336-M03-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged APOA2 is approximately 0.03ng/ml as a capture antibody.
Applications: IHC-P,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy APOA2 monoclonal antibody (M03), clone 1H6 now

Add to cart