Brand: | Abnova |
Reference: | H00000332-M01 |
Product name: | BIRC5 monoclonal antibody (M01), clone 5B10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant BIRC5. |
Clone: | 5B10 |
Isotype: | IgG2a Kappa |
Gene id: | 332 |
Gene name: | BIRC5 |
Gene alias: | API4|EPR-1 |
Gene description: | baculoviral IAP repeat-containing 5 |
Genbank accession: | NM_001168 |
Immunogen: | BIRC5 (NP_001159, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLGE |
Protein accession: | NP_001159 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Western blot analysis of BIRC5 over-expressed 293 cell line, cotransfected with BIRC5 Validated Chimera RNAi ( Cat # H00000332-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with BIRC5 monoclonal antibody (M01), clone 5B10 (Cat # H00000332-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. |
Applications: | IF,S-ELISA,ELISA,WB-Re,WB-Tr,IP,RNAi-Ab |
Shipping condition: | Dry Ice |
Publications: | Survivin expression induced by endothelin-1 promotes myofibroblast resistance to apoptosis.Horowitz JC, Ajayi IO, Kulasekaran P, Rogers DS, White JB, Townsend SK, White ES, Nho RS, Higgins PD, Huang SK, Sisson TH. Int J Biochem Cell Biol. 2011 Oct 25. |