Brand: | Abnova |
Reference: | H00000328-M05 |
Product name: | APEX1 monoclonal antibody (M05), clone 3E12 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant APEX1. |
Clone: | 3E12 |
Isotype: | IgG2a Kappa |
Gene id: | 328 |
Gene name: | APEX1 |
Gene alias: | APE|APE-1|APE1|APEN|APEX|APX|HAP1|REF-1|REF1 |
Gene description: | APEX nuclease (multifunctional DNA repair enzyme) 1 |
Genbank accession: | BC002338 |
Immunogen: | APEX1 (AAH02338, 1 a.a. ~ 318 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYEDPPDQKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGEEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL |
Protein accession: | AAH02338 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged APEX1 is 0.1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,IP |
Shipping condition: | Dry Ice |