Brand: | Abnova |
Reference: | H00000328-D02P |
Product name: | APEX1 purified MaxPab rabbit polyclonal antibody (D02P) |
Product description: | Rabbit polyclonal antibody raised against a full-length human APEX1 protein. |
Gene id: | 328 |
Gene name: | APEX1 |
Gene alias: | APE|APE-1|APE1|APEN|APEX|APX|HAP1|REF-1|REF1 |
Gene description: | APEX nuclease (multifunctional DNA repair enzyme) 1 |
Genbank accession: | NM_001641.1 |
Immunogen: | APEX1 (NP_001632.1, 1 a.a. ~ 318 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYEDPPDHKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL |
Protein accession: | NP_001632.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | APEX1 MaxPab rabbit polyclonal antibody. Western Blot analysis of APEX1 expression in K-562. |
Applications: | WB-Ce,IF,WB-Tr |
Shipping condition: | Dry Ice |