Brand: | Abnova |
Reference: | H00000322-A01 |
Product name: | APBB1 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant APBB1. |
Gene id: | 322 |
Gene name: | APBB1 |
Gene alias: | FE65|MGC:9072|RIR |
Gene description: | amyloid beta (A4) precursor protein-binding, family B, member 1 (Fe65) |
Genbank accession: | NM_001164 |
Immunogen: | APBB1 (NP_001155, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MSVPSSLSQSAINANSHGGPALSLPLPLHAAHNQLLNAKLQATAVGPKDLRSAMGEGGGPEPGPANAKWLKEGQNQLRRAATAHRDQNRNVTLTLAEEAS |
Protein accession: | NP_001155 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | APBB1 polyclonal antibody (A01), Lot # 060717JCS1 Western Blot analysis of APBB1 expression in 293 ( Cat # L026V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |