NUDT2 monoclonal antibody (M03), clone S1 View larger

NUDT2 monoclonal antibody (M03), clone S1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NUDT2 monoclonal antibody (M03), clone S1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about NUDT2 monoclonal antibody (M03), clone S1

Brand: Abnova
Reference: H00000318-M03
Product name: NUDT2 monoclonal antibody (M03), clone S1
Product description: Mouse monoclonal antibody raised against a full-length recombinant NUDT2.
Clone: S1
Isotype: IgG1 Kappa
Gene id: 318
Gene name: NUDT2
Gene alias: APAH1|MGC10404
Gene description: nudix (nucleoside diphosphate linked moiety X)-type motif 2
Genbank accession: BC004926
Immunogen: NUDT2 (AAH04926, 1 a.a. ~ 147 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRETQEEAGIEAGQLTIIEGFKRELNYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQFLCSIEA
Protein accession: AAH04926
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000318-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (41.91 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000318-M03-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged NUDT2 is approximately 1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy NUDT2 monoclonal antibody (M03), clone S1 now

Add to cart