Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of NUDT2 monoclonal antibody (M01), clone 4A4-3C3
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about NUDT2 monoclonal antibody (M01), clone 4A4-3C3
| Brand: | Abnova |
| Reference: | H00000318-M01 |
| Product name: | NUDT2 monoclonal antibody (M01), clone 4A4-3C3 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant NUDT2. |
| Clone: | 4A4-3C3 |
| Isotype: | IgG1 kappa |
| Gene id: | 318 |
| Gene name: | NUDT2 |
| Gene alias: | APAH1|MGC10404 |
| Gene description: | nudix (nucleoside diphosphate linked moiety X)-type motif 2 |
| Genbank accession: | BC004926 |
| Immunogen: | NUDT2 (AAH04926, 1 a.a. ~ 147 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRETQEEAGIEAGQLTIIEGFKRELNYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQFLCSIEA |
| Protein accession: | AAH04926 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (41.91 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | NUDT2 monoclonal antibody (M01), clone 4A4-3C3 Western Blot analysis of NUDT2 expression in Jurkat ( Cat # L017V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Nudix-type motif 2 (NUDT2) in human breast carcinoma: A potent prognostic factor associated with cell proliferation.Oka K, Suzuki T, Onodera Y, Miki Y, Takagi K, Nagasaki S, Akahira JI, Ishida T, Watanabe M, Hirakawa H, Ohuchi N, Sasano H. Int J Cancer. 2010 Jun 9. [Epub ahead of print] |