NUDT2 purified MaxPab mouse polyclonal antibody (B01P) View larger

NUDT2 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NUDT2 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,WB-Tr

More info about NUDT2 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00000318-B01P
Product name: NUDT2 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human NUDT2 protein.
Gene id: 318
Gene name: NUDT2
Gene alias: APAH1|MGC10404
Gene description: nudix (nucleoside diphosphate linked moiety X)-type motif 2
Genbank accession: NM_001161
Immunogen: NUDT2 (NP_001152.1, 1 a.a. ~ 147 a.a) full-length human protein.
Immunogen sequence/protein sequence: MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRETQEEAGIEAGQLTIIEGFKRELNYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQFLCSIEA
Protein accession: NP_001152.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000318-B01P-13-15-1.jpg
Application image note: Western Blot analysis of NUDT2 expression in transfected 293T cell line (H00000318-T01) by NUDT2 MaxPab polyclonal antibody.

Lane 1: NUDT2 transfected lysate(16.17 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy NUDT2 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart