ANXA11 purified MaxPab mouse polyclonal antibody (B01P) View larger

ANXA11 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ANXA11 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,IF,WB-Tr

More info about ANXA11 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00000311-B01P
Product name: ANXA11 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human ANXA11 protein.
Gene id: 311
Gene name: ANXA11
Gene alias: ANX11|CAP50
Gene description: annexin A11
Genbank accession: NM_001157.2
Immunogen: ANXA11 (NP_001148.1, 1 a.a. ~ 505 a.a) full-length human protein.
Immunogen sequence/protein sequence: MSYPGYPPPPGGYPPAAPGGGPWGGAAYPPPPSMPPIGLDNVATYAGQFNQDYLSGMAANMSGTFGGANMPNLYPGAPGAGYPPVPPGGFGQPPSAQQPVPPYGMYPPPGGNPPSRMPSYPPYPGAPVPGQPMPPPGQQPPGAYPGQPPVTYPGQPPVPLPGQQQPVPSYPGYPGSGTVTPAVPPTQFGSRGTITDAPGFDPLRDAEVLRKAMKGFGTDEQAIIDCLGSRSNKQRQQILLSFKTAYGKDLIKDLKSELSGNFEKTILALMKTPVLFDIYEIKEAIKGVGTDEACLIEILASRSNEHIRELNRAYKAEFKKTLEEAIRSDTSGHFQRLLISLSQGNRDESTNVDMSLAQRDAQELYAAGENRLGTDESKFNAVLCSRSRAHLVAVFNEYQRMTGRDIEKSICREMSGDLEEGMLAVVKCLKNTPAFFAERLNKAMRGAGTKDRTLIRIMVSRSETDLLDIRSEYKRMYGKSLYHDISGDTSGDYRKILLKICGGND
Protein accession: NP_001148.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000311-B01P-13-15-1.jpg
Application image note: Western Blot analysis of ANXA11 expression in transfected 293T cell line (H00000311-T01) by ANXA11 MaxPab polyclonal antibody.

Lane 1: ANXA11 transfected lysate(55.55 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ANXA11 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart