ANXA5 monoclonal antibody (M01), clone 1F4-1A5 View larger

ANXA5 monoclonal antibody (M01), clone 1F4-1A5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ANXA5 monoclonal antibody (M01), clone 1F4-1A5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr,IP

More info about ANXA5 monoclonal antibody (M01), clone 1F4-1A5

Brand: Abnova
Reference: H00000308-M01
Product name: ANXA5 monoclonal antibody (M01), clone 1F4-1A5
Product description: Mouse monoclonal antibody raised against a full length recombinant ANXA5.
Clone: 1F4-1A5
Isotype: IgG1 kappa
Gene id: 308
Gene name: ANXA5
Gene alias: ANX5|ENX2|PP4
Gene description: annexin A5
Genbank accession: BC001429
Immunogen: ANXA5 (AAH01429, 1 a.a. ~ 320 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD
Protein accession: AAH01429
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000308-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (60.94 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000308-M01-3-7-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to ANXA5 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]
Applications: WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr,IP
Shipping condition: Dry Ice
Publications: Proteomics and bioinformatics analysis of lovastatin-induced differentiation in ARO cells.Shui HA, Hsia CW, Chen HM, Chang TC, Wang CY.
J Proteomics. 2011 Nov 7.

Reviews

Buy ANXA5 monoclonal antibody (M01), clone 1F4-1A5 now

Add to cart