ANXA4 MaxPab rabbit polyclonal antibody (D01) View larger

ANXA4 MaxPab rabbit polyclonal antibody (D01)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ANXA4 MaxPab rabbit polyclonal antibody (D01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesRabbit
ApplicationsWB-Ce,WB-Ti,WB-Tr,IP

More info about ANXA4 MaxPab rabbit polyclonal antibody (D01)

Brand: Abnova
Reference: H00000307-D01
Product name: ANXA4 MaxPab rabbit polyclonal antibody (D01)
Product description: Rabbit polyclonal antibody raised against a full-length human ANXA4 protein.
Gene id: 307
Gene name: ANXA4
Gene alias: ANX4|DKFZp686H02120|MGC75105|PIG28|ZAP36
Gene description: annexin A4
Genbank accession: NM_001153.2
Immunogen: ANXA4 (NP_001144.1, 1 a.a. ~ 321 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAMATKGGTVKAASGFNAMEDAQTLRKAMKGLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQVIVGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDEGNYLDDALVRQDAQDLYEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLAIVKCMRNKSAYFAEKLYKSMKGLGTDDNTLIRVMVSRAEIDMLDIRAHFKRLYGKSLYSFIKGDTSGDYRKVLLVLCGGDD
Protein accession: NP_001144.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: H00000307-D01-2-A3-1.jpg
Application image note: ANXA4 MaxPab rabbit polyclonal antibody. Western Blot analysis of ANXA4 expression in human stomach.
Applications: WB-Ce,WB-Ti,WB-Tr,IP
Shipping condition: Dry Ice

Reviews

Buy ANXA4 MaxPab rabbit polyclonal antibody (D01) now

Add to cart