Brand: | Abnova |
Reference: | H00000307-D01 |
Product name: | ANXA4 MaxPab rabbit polyclonal antibody (D01) |
Product description: | Rabbit polyclonal antibody raised against a full-length human ANXA4 protein. |
Gene id: | 307 |
Gene name: | ANXA4 |
Gene alias: | ANX4|DKFZp686H02120|MGC75105|PIG28|ZAP36 |
Gene description: | annexin A4 |
Genbank accession: | NM_001153.2 |
Immunogen: | ANXA4 (NP_001144.1, 1 a.a. ~ 321 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MAMATKGGTVKAASGFNAMEDAQTLRKAMKGLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQVIVGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDEGNYLDDALVRQDAQDLYEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLAIVKCMRNKSAYFAEKLYKSMKGLGTDDNTLIRVMVSRAEIDMLDIRAHFKRLYGKSLYSFIKGDTSGDYRKVLLVLCGGDD |
Protein accession: | NP_001144.1 |
Storage buffer: | No additive |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: |  |
Application image note: | ANXA4 MaxPab rabbit polyclonal antibody. Western Blot analysis of ANXA4 expression in human stomach. |
Applications: | WB-Ce,WB-Ti,WB-Tr,IP |
Shipping condition: | Dry Ice |