Brand: | Abnova |
Reference: | H00000291-P02 |
Product name: | SLC25A4 (Human) Recombinant Protein (P02) |
Product description: | Human SLC25A4 full-length ORF (AAH08664.1, 1 a.a. - 298 a.a.) recombinant protein with GST tag. |
Gene id: | 291 |
Gene name: | SLC25A4 |
Gene alias: | AAC1|ANT|ANT1|PEO2|PEO3|T1 |
Gene description: | solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4 |
Genbank accession: | BC008664.1 |
Immunogen sequence/protein sequence: | MGDHAWSFLKDFLAGGVAAAVSKTAVAPIERVKLLLRVQHASRQISAEKQYKGIIDCVVRIPKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKQLFLGGVDRHKQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKGAAQREFHGLGDCIIKIFKSDGLRGLYQGFNVSVQGIIIYRAAYFGVYDTAKGMLPDPKNVHIFVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKGADIMYTGTVDCWRKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKYV |
Protein accession: | AAH08664.1 |
Preparation method: | in vitro wheat germ expression system |
Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue |
Quality control testing picture: | ![qc_test-H00000291-P02-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00000291-P02-1.jpg) |
Note: | Best use within three months from the date of receipt of this protein. |
Tag: | GST |
Product type: | Proteins |
Host species: | Wheat Germ (in vitro) |
Antigen species / target species: | Human |
Applications: | AP,Array,ELISA,WB-Re |
Shipping condition: | Dry Ice |