AMY2B monoclonal antibody (M01), clone 2B12 View larger

AMY2B monoclonal antibody (M01), clone 2B12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of AMY2B monoclonal antibody (M01), clone 2B12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about AMY2B monoclonal antibody (M01), clone 2B12

Brand: Abnova
Reference: H00000280-M01
Product name: AMY2B monoclonal antibody (M01), clone 2B12
Product description: Mouse monoclonal antibody raised against a partial recombinant AMY2B.
Clone: 2B12
Isotype: IgG2a Kappa
Gene id: 280
Gene name: AMY2B
Gene alias: AMY2
Gene description: amylase, alpha 2B (pancreatic)
Genbank accession: NM_020978
Immunogen: AMY2B (NP_066188, 19 a.a. ~ 117 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHM
Protein accession: NP_066188
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000280-M01-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged AMY2B is 1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy AMY2B monoclonal antibody (M01), clone 2B12 now

Add to cart