AMY2B polyclonal antibody (A01) View larger

AMY2B polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of AMY2B polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about AMY2B polyclonal antibody (A01)

Brand: Abnova
Reference: H00000280-A01
Product name: AMY2B polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant AMY2B.
Gene id: 280
Gene name: AMY2B
Gene alias: AMY2
Gene description: amylase, alpha 2B (pancreatic)
Genbank accession: NM_020978
Immunogen: AMY2B (NP_066188, 19 a.a. ~ 117 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: PNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHM
Protein accession: NP_066188
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000280-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy AMY2B polyclonal antibody (A01) now

Add to cart