Brand: | Abnova |
Reference: | H00000279-P01 |
Product name: | AMY2A (Human) Recombinant Protein (P01) |
Product description: | Human AMY2A full-length ORF ( NP_000690.1, 1 a.a. - 511 a.a.) recombinant protein with GST-tag at N-terminal. |
Gene id: | 279 |
Gene name: | AMY2A |
Gene alias: | AMY2|AMY2B|PA |
Gene description: | amylase, alpha 2A (pancreatic) |
Genbank accession: | NM_000699.2 |
Immunogen sequence/protein sequence: | MKFFLLLFTIGFCWAQYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL |
Protein accession: | NP_000690.1 |
Preparation method: | in vitro wheat germ expression system |
Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Quality control testing picture: | ![qc_test-H00000279-P01-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00000279-P01-1.jpg) |
Note: | Best use within three months from the date of receipt of this protein. |
Tag: | GST |
Product type: | Proteins |
Host species: | Wheat Germ (in vitro) |
Antigen species / target species: | Human |
Applications: | AP,Array,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Serological proteome analysis reveals new specific biases in the IgM and IgG autoantibody repertoires in autoimmune polyendocrine syndrome type 1.Dubucquoi S, Proust-Lemoine E, Kemp EH, Ryndak A, Lefevre-Dutoit V, Bellart M, Saugier-Veber P, Duban-Deweer S, Wemeau J, Prin L, Lefranc D. Autoimmunity. 2015 Aug. 20. [Epub ahead of print] |