AMY2A purified MaxPab rabbit polyclonal antibody (D01P) View larger

AMY2A purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of AMY2A purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ti,WB-Tr

More info about AMY2A purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00000279-D01P
Product name: AMY2A purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human AMY2A protein.
Gene id: 279
Gene name: AMY2A
Gene alias: AMY2|AMY2B|PA
Gene description: amylase, alpha 2A (pancreatic)
Genbank accession: NM_000699.2
Immunogen: AMY2A (NP_000690.1, 1 a.a. ~ 511 a.a) full-length human protein.
Immunogen sequence/protein sequence: MKFFLLLFTIGFCWAQYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Protein accession: NP_000690.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00000279-D01P-2-A7-1.jpg
Application image note: AMY2A MaxPab rabbit polyclonal antibody. Western Blot analysis of AMY2A expression in human pancreas.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy AMY2A purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart