Brand: | Abnova |
Reference: | H00000276-M04 |
Product name: | AMY1A monoclonal antibody (M04), clone 2D4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant AMY1A. |
Clone: | 2D4 |
Isotype: | IgG2a Kappa |
Gene id: | 276 |
Gene name: | AMY1A |
Gene alias: | AMY1|AMY1B |
Gene description: | amylase, alpha 1A (salivary) |
Genbank accession: | NM_001008221 |
Immunogen: | AMY1A (NP_001008222, 172 a.a. ~ 245 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | VRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFI |
Protein accession: | NP_001008222 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (33.88 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to AMY1A on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml] |
Applications: | WB-Ti,IHC-P,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |