Brand: | Abnova |
Reference: | H00000274-M01 |
Product name: | BIN1 monoclonal antibody (M01), clone 1H1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant BIN1. |
Clone: | 1H1 |
Isotype: | IgG1 Kappa |
Gene id: | 274 |
Gene name: | BIN1 |
Gene alias: | AMPH2|AMPHL|DKFZp547F068|MGC10367|SH3P9 |
Gene description: | bridging integrator 1 |
Genbank accession: | NM_004305 |
Immunogen: | BIN1 (NP_004296, 355 a.a. ~ 454 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | VVETFPATVNGTVEGGSGAGRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKELEKCRGVFPENFTERVP |
Protein accession: | NP_004296 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | BIN1 monoclonal antibody (M01), clone 1H1 Western Blot analysis of BIN1 expression in Hela S3 NE ( Cat # L013V3 ). |
Applications: | WB-Ce,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |