BIN1 MaxPab mouse polyclonal antibody (B01) View larger

BIN1 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of BIN1 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about BIN1 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00000274-B01
Product name: BIN1 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human BIN1 protein.
Gene id: 274
Gene name: BIN1
Gene alias: AMPH2|AMPHL|DKFZp547F068|MGC10367|SH3P9
Gene description: bridging integrator 1
Genbank accession: NM_139348
Immunogen: BIN1 (NP_647598, 1 a.a. ~ 482 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAEMGSKGVTAGKIASNVQKKLTRAQEKVLQKLGKADETKDEQFEQCVQNFNKQLTEGTRLQKDLRTYLASVKAMHEASKKLNECLQEVYEPDWPGRDEANKIAENNDLLWMDYHQKLVDQALLTMDTYLGQFPDIKSRIAKRGRKLVDYDSARHHYESLQTAKKKDEAKIAKAEEELIKAQKVFEEMNVDLQEELPSLWNSRVGFYVNTFQSIAGLEENFHKEMSKLNQNLNDVLVGLEKQHGSNTFTVKAQPSDNAPAKGNKSPSPPDGSPAATPEIRVNHEPEPAGGATPGATLPKSPSQLRKGPPVPPPPKHTPSKEVKQEQILSLFEDTFVPEISVTTPSQPAEASEVAGGTQPAAGAQEPGETAASEAASSSLPAVVVETFPATVNGTVEGGSGAGRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKELEKCRGVFPENFTERVP
Protein accession: NP_647598
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000274-B01-13-15-1.jpg
Application image note: Western Blot analysis of BIN1 expression in transfected 293T cell line (H00000274-T01) by BIN1 MaxPab polyclonal antibody.

Lane 1: BIN1 transfected lysate(53.02 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy BIN1 MaxPab mouse polyclonal antibody (B01) now

Add to cart