Brand: | Abnova |
Reference: | H00000271-M09A |
Product name: | AMPD2 monoclonal antibody (M09A), clone 6A8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant AMPD2. |
Clone: | 6A8 |
Isotype: | IgG2a Kappa |
Gene id: | 271 |
Gene name: | AMPD2 |
Gene alias: | - |
Gene description: | adenosine monophosphate deaminase 2 (isoform L) |
Genbank accession: | NM_139156 |
Immunogen: | AMPD2 (NP_631895, 86 a.a. ~ 185 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | ISQDVKLEPDILLRAKQDFLKTDSDSDLQLYKEQGEGQGDRSLRERDVLEREFQRVTISGEEKCGVPFTDLLDAAKSVVRALFIREKYMALSLQSFCPTT |
Protein accession: | NP_631895 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | AMPD2 monoclonal antibody (M09A), clone 6A8. Western Blot analysis of AMPD2 expression in human liver. |
Applications: | WB-Ce,WB-Ti,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |