AMPD2 monoclonal antibody (M09), clone 6A8 View larger

AMPD2 monoclonal antibody (M09), clone 6A8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of AMPD2 monoclonal antibody (M09), clone 6A8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,WB-Ti,ELISA,WB-Re,WB-Tr

More info about AMPD2 monoclonal antibody (M09), clone 6A8

Brand: Abnova
Reference: H00000271-M09
Product name: AMPD2 monoclonal antibody (M09), clone 6A8
Product description: Mouse monoclonal antibody raised against a partial recombinant AMPD2.
Clone: 6A8
Isotype: IgG2a Kappa
Gene id: 271
Gene name: AMPD2
Gene alias: -
Gene description: adenosine monophosphate deaminase 2 (isoform L)
Genbank accession: NM_139156
Immunogen: AMPD2 (NP_631895, 86 a.a. ~ 185 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ISQDVKLEPDILLRAKQDFLKTDSDSDLQLYKEQGEGQGDRSLRERDVLEREFQRVTISGEEKCGVPFTDLLDAAKSVVRALFIREKYMALSLQSFCPTT
Protein accession: NP_631895
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000271-M09-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000271-M09-2-A1-1.jpg
Application image note: AMPD2 monoclonal antibody (M09), clone 6A8. Western Blot analysis of AMPD2 expression in human liver.
Applications: WB-Ce,WB-Ti,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy AMPD2 monoclonal antibody (M09), clone 6A8 now

Add to cart