AMELX purified MaxPab rabbit polyclonal antibody (D01P) View larger

AMELX purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of AMELX purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr

More info about AMELX purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00000265-D01P
Product name: AMELX purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human AMELX protein.
Gene id: 265
Gene name: AMELX
Gene alias: AIH1|ALGN|AMG|AMGL|AMGX
Gene description: amelogenin (amelogenesis imperfecta 1, X-linked)
Genbank accession: NM_001142.2
Immunogen: AMELX (NP_001133.1, 1 a.a. ~ 191 a.a) full-length human protein.
Immunogen sequence/protein sequence: MGTWILFACLLGAAFAMPLPPHPGHPGYINFSYEVLTPLKWYQSIRPPYPSYGYEPMGGWLHHQIIPVLSQQHPPTHTLQPHHHIPVVPAQQPVIPQQPMMPVPGQHSMTPIQHHQPNLPPPAQQPYQPQPVQPQPHQPMQPQPPVHPMQPLPPQPPLPPMFPMQPLPPMLPDLTLEAWPSTDKTKREEVD
Protein accession: NP_001133.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00000265-D01P-13-15-1.jpg
Application image note: Western Blot analysis of AMELX expression in transfected 293T cell line (H00000265-T01) by AMELX MaxPab polyclonal antibody.

Lane 1: AMELX transfected lysate(21.60 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice
Publications: Cloning and Expression Analysis of Human Amelogenin in Nicotiana benthamiana Plants by Means of a Transient Expression System.Pegoraro M, Mati? S, Pergolizzi B, Iannarelli L, Rossi AM, Morra M, Noris E.
Mol Biotechnol. 2017 Aug 11. [Epub ahead of print]

Reviews

Buy AMELX purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart