Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | WB-Tr |
Brand: | Abnova |
Reference: | H00000265-D01P |
Product name: | AMELX purified MaxPab rabbit polyclonal antibody (D01P) |
Product description: | Rabbit polyclonal antibody raised against a full-length human AMELX protein. |
Gene id: | 265 |
Gene name: | AMELX |
Gene alias: | AIH1|ALGN|AMG|AMGL|AMGX |
Gene description: | amelogenin (amelogenesis imperfecta 1, X-linked) |
Genbank accession: | NM_001142.2 |
Immunogen: | AMELX (NP_001133.1, 1 a.a. ~ 191 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MGTWILFACLLGAAFAMPLPPHPGHPGYINFSYEVLTPLKWYQSIRPPYPSYGYEPMGGWLHHQIIPVLSQQHPPTHTLQPHHHIPVVPAQQPVIPQQPMMPVPGQHSMTPIQHHQPNLPPPAQQPYQPQPVQPQPHQPMQPQPPVHPMQPLPPQPPLPPMFPMQPLPPMLPDLTLEAWPSTDKTKREEVD |
Protein accession: | NP_001133.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of AMELX expression in transfected 293T cell line (H00000265-T01) by AMELX MaxPab polyclonal antibody. Lane 1: AMELX transfected lysate(21.60 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Tr |
Shipping condition: | Dry Ice |
Publications: | Cloning and Expression Analysis of Human Amelogenin in Nicotiana benthamiana Plants by Means of a Transient Expression System.Pegoraro M, Mati? S, Pergolizzi B, Iannarelli L, Rossi AM, Morra M, Noris E. Mol Biotechnol. 2017 Aug 11. [Epub ahead of print] |