Brand: | Abnova |
Reference: | H00000251-M07 |
Product name: | ALPPL2 monoclonal antibody (M07), clone 2B3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ALPPL2. |
Clone: | 2B3 |
Isotype: | IgG2a Kappa |
Gene id: | 251 |
Gene name: | ALPPL2 |
Gene alias: | ALPG|ALPPL|GCAP |
Gene description: | alkaline phosphatase, placental-like 2 |
Genbank accession: | NM_031313 |
Immunogen: | ALPPL2 (NP_112603, 365 a.a. ~ 454 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSAVPLDGETHAGE |
Protein accession: | NP_112603 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.64 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to ALPPL2 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml] |
Applications: | WB-Ce,IHC-P,ELISA,WB-Re,WB-Tr,IP,RNAi-Ab |
Shipping condition: | Dry Ice |