ALOX15B monoclonal antibody (M05), clone 4A7 View larger

ALOX15B monoclonal antibody (M05), clone 4A7

H00000247-M05_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ALOX15B monoclonal antibody (M05), clone 4A7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re

More info about ALOX15B monoclonal antibody (M05), clone 4A7

Brand: Abnova
Reference: H00000247-M05
Product name: ALOX15B monoclonal antibody (M05), clone 4A7
Product description: Mouse monoclonal antibody raised against a partial recombinant ALOX15B.
Clone: 4A7
Isotype: IgG2a Kappa
Gene id: 247
Gene name: ALOX15B
Gene alias: 15-LOX-2
Gene description: arachidonate 15-lipoxygenase, type B
Genbank accession: BC035217
Immunogen: ALOX15B (AAH35217.1, 181 a.a. ~ 280 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: NANFYLQAGSAFAEMKIKGLLDRKGLWRSLNEMKRIFNFRRTPAAEHAFEHWQEDAFFASQFLNGLNPVLIRRCHYLPKNFPVTDAMVASVLGPGTSLQA
Protein accession: AAH35217.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000247-M05-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000247-M05-9-17-1.jpg
Application image note: Detection limit for recombinant GST tagged ALOX15B is approximately 10ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ALOX15B monoclonal antibody (M05), clone 4A7 now

Add to cart