Brand: | Abnova |
Reference: | H00000242-M01 |
Product name: | ALOX12B monoclonal antibody (M01), clone 3G12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ALOX12B. |
Clone: | 3G12 |
Isotype: | IgG2a Kappa |
Gene id: | 242 |
Gene name: | ALOX12B |
Gene alias: | 12R-LOX |
Gene description: | arachidonate 12-lipoxygenase, 12R type |
Genbank accession: | NM_001139 |
Immunogen: | ALOX12B (NP_001130, 171 a.a. ~ 261 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | NPNRPEWNGYIPGFPILINFKATKFLNLNLRYSFLKTASFFVRLGPMALAFKVRGLLDCKHSWKRLKDIRKIFPGKKSVVSEYVAEHWAED |
Protein accession: | NP_001130 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |