Brand: | Abnova |
Reference: | H00000238-M01 |
Product name: | ALK monoclonal antibody (M01), clone 4D10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ALK. |
Clone: | 4D10 |
Isotype: | IgG1 Kappa |
Gene id: | 238 |
Gene name: | ALK |
Gene alias: | CD246|Ki-1|TFG/ALK |
Gene description: | anaplastic lymphoma receptor tyrosine kinase |
Genbank accession: | NM_004304 |
Immunogen: | ALK (NP_004295, 251 a.a. ~ 350 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | DSFPFLSHRSRYGLECSFDFPCELEYSPPLHDLRNQSWSWRRIPSEEASQMDLLDGPGAERSKEMPRGSFLLLNTSADSKHTILSPWMRSSSEHCTLAVS |
Protein accession: | NP_004295 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |