Brand: | Abnova |
Reference: | H00000226-M03 |
Product name: | ALDOA monoclonal antibody (M03), clone 2E6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ALDOA. |
Clone: | 2E6 |
Isotype: | IgG2a Kappa |
Gene id: | 226 |
Gene name: | ALDOA |
Gene alias: | ALDA|MGC10942|MGC17716|MGC17767 |
Gene description: | aldolase A, fructose-bisphosphate |
Genbank accession: | BC010660 |
Immunogen: | ALDOA (AAH10660.1, 21 a.a. ~ 95 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | HRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFHETLYQKADDGRPFP |
Protein accession: | AAH10660.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (33.99 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Application image: |  |
Application image note: | ALDOA monoclonal antibody (M03), clone 2E6. Western Blot analysis of ALDOA expression in HepG2 ( Cat # L019V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |