Brand: | Abnova |
Reference: | H00000217-M17 |
Product name: | ALDH2 monoclonal antibody (M17), clone 4C11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ALDH2. |
Clone: | 4C11 |
Isotype: | IgG2a Kappa |
Gene id: | 217 |
Gene name: | ALDH2 |
Gene alias: | ALDH-E2|ALDHI|ALDM|MGC1806 |
Gene description: | aldehyde dehydrogenase 2 family (mitochondrial) |
Genbank accession: | BC002967 |
Immunogen: | ALDH2 (AAH02967, 408 a.a. ~ 517 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | DGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSTYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKNS |
Protein accession: | AAH02967 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged ALDH2 is approximately 1ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |