ALDH2 monoclonal antibody (M09), clone 2A7 View larger

ALDH2 monoclonal antibody (M09), clone 2A7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ALDH2 monoclonal antibody (M09), clone 2A7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about ALDH2 monoclonal antibody (M09), clone 2A7

Brand: Abnova
Reference: H00000217-M09
Product name: ALDH2 monoclonal antibody (M09), clone 2A7
Product description: Mouse monoclonal antibody raised against a partial recombinant ALDH2.
Clone: 2A7
Isotype: IgG2a Kappa
Gene id: 217
Gene name: ALDH2
Gene alias: ALDH-E2|ALDHI|ALDM|MGC1806
Gene description: aldehyde dehydrogenase 2 family (mitochondrial)
Genbank accession: BC002967
Immunogen: ALDH2 (AAH02967, 408 a.a. ~ 517 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSTYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKNS
Protein accession: AAH02967
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000217-M09-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000217-M09-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged ALDH2 is approximately 1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ALDH2 monoclonal antibody (M09), clone 2A7 now

Add to cart