ABCD1 monoclonal antibody (M01), clone 4B5 View larger

ABCD1 monoclonal antibody (M01), clone 4B5

H00000215-M01_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ABCD1 monoclonal antibody (M01), clone 4B5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about ABCD1 monoclonal antibody (M01), clone 4B5

Brand: Abnova
Reference: H00000215-M01
Product name: ABCD1 monoclonal antibody (M01), clone 4B5
Product description: Mouse monoclonal antibody raised against a partial recombinant ABCD1.
Clone: 4B5
Isotype: IgG2a Kappa
Gene id: 215
Gene name: ABCD1
Gene alias: ABC42|ALD|ALDP|AMN
Gene description: ATP-binding cassette, sub-family D (ALD), member 1
Genbank accession: BC015541
Immunogen: ABCD1 (AAH15541, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MPVLSRPRPWRGNTLKRTAVLLALAAYGAHKVYPLVRQCLAPARGLQAPAGEPTQEASGVAAAKAGMNRVFLQRLLWLLRLLFPRVLCRETGLLALHSAA
Protein accession: AAH15541
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy ABCD1 monoclonal antibody (M01), clone 4B5 now

Add to cart