Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ALAS2 monoclonal antibody (M01), clone 6C1
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about ALAS2 monoclonal antibody (M01), clone 6C1
| Brand: | Abnova |
| Reference: | H00000212-M01 |
| Product name: | ALAS2 monoclonal antibody (M01), clone 6C1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ALAS2. |
| Clone: | 6C1 |
| Isotype: | IgG2a Kappa |
| Gene id: | 212 |
| Gene name: | ALAS2 |
| Gene alias: | ALAS-E|ALASE|ANH1|ASB|FLJ93603|XLSA |
| Gene description: | aminolevulinate, delta-, synthase 2 |
| Genbank accession: | NM_000032 |
| Immunogen: | ALAS2 (NP_000023, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MVTAAMLLQCCPVLARGPTSLLGKVVKTHQFLFGIGRCPILATQGPNCSQIHLKATKAGGDSPSWAKGHCPFMLSELQDGKSKIVQKAAPEVQEDVKAFK |
| Protein accession: | NP_000023 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | ALAS2 monoclonal antibody (M01), clone 6C1. Western Blot analysis of ALAS2 expression in Raw 264.7. |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Emodin can induce K562 cells to erythroid differentiation and improve the expression of globin genes.Ma YN, Chen MT, Wu ZK, Zhao HL, Yu HC, Yu J, Zhang JW Mol Cell Biochem. 2013 Jun 7. |