Brand: | Abnova |
Reference: | H00000207-M19 |
Product name: | AKT1 monoclonal antibody (M19), clone 4E2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant AKT1. |
Clone: | 4E2 |
Isotype: | IgG2b Kappa |
Gene id: | 207 |
Gene name: | AKT1 |
Gene alias: | AKT|MGC99656|PKB|PKB-ALPHA|PRKBA|RAC|RAC-ALPHA |
Gene description: | v-akt murine thymoma viral oncogene homolog 1 |
Genbank accession: | BC000479 |
Immunogen: | AKT1 (AAH00479.1, 127 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | DNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIVAKDEVAHTLTENR |
Protein accession: | AAH00479.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (33.77 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to AKT1 on HeLa cell . [antibody concentration 10 ug/ml] |
Applications: | IF,ELISA,WB-Re |
Shipping condition: | Dry Ice |