Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of AKT1 monoclonal antibody (M01), clone 4C3
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,IP,RNAi-Ab,PLA-Ce |
More info about AKT1 monoclonal antibody (M01), clone 4C3
| Brand: | Abnova |
| Reference: | H00000207-M01 |
| Product name: | AKT1 monoclonal antibody (M01), clone 4C3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant AKT1. |
| Clone: | 4C3 |
| Isotype: | IgG2a Kappa |
| Gene id: | 207 |
| Gene name: | AKT1 |
| Gene alias: | AKT|MGC99656|PKB|PKB-ALPHA|PRKBA|RAC|RAC-ALPHA |
| Gene description: | v-akt murine thymoma viral oncogene homolog 1 |
| Genbank accession: | BC000479 |
| Immunogen: | AKT1 (AAH00479, 381 a.a. ~ 480 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKKLSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA |
| Protein accession: | AAH00479 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western blot analysis of AKT1 over-expressed 293 cell line, cotransfected with AKT1 Validated Chimera RNAi ( Cat # H00000207-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with AKT1 monoclonal antibody (M01) clone 4C3 (Cat # H00000207-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. |
| Applications: | S-ELISA,ELISA,IP,RNAi-Ab,PLA-Ce |
| Shipping condition: | Dry Ice |