AK2 monoclonal antibody (M01), clone 3F1 View larger

AK2 monoclonal antibody (M01), clone 3F1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of AK2 monoclonal antibody (M01), clone 3F1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about AK2 monoclonal antibody (M01), clone 3F1

Brand: Abnova
Reference: H00000204-M01
Product name: AK2 monoclonal antibody (M01), clone 3F1
Product description: Mouse monoclonal antibody raised against a full-length recombinant AK2.
Clone: 3F1
Isotype: IgG2a Kappa
Gene id: 204
Gene name: AK2
Gene alias: ADK2
Gene description: adenylate kinase 2
Genbank accession: BC009405
Immunogen: AK2 (AAH09405, 1 a.a. ~ 239 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAPSVPAAEPEYPKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHTQTTPLIEYYRKRGIHSAIDASQTPDVVFASILAAFSKATCKDLVMFI
Protein accession: AAH09405
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000204-M01-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged AK2 is 1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy AK2 monoclonal antibody (M01), clone 3F1 now

Add to cart