AK2 purified MaxPab rabbit polyclonal antibody (D01P) View larger

AK2 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of AK2 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesRabbit
ApplicationsWB-Ti,WB-Tr

More info about AK2 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00000204-D01P
Product name: AK2 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human AK2 protein.
Gene id: 204
Gene name: AK2
Gene alias: ADK2
Gene description: adenylate kinase 2
Genbank accession: NM_001625.2
Immunogen: AK2 (NP_001616.1, 1 a.a. ~ 239 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAPSVPAAEPEYPKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHTQTTPLIEYYRKRGIHSAIDASQTPDVVFASILAAFSKATCKDLVMFI
Protein accession: NP_001616.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: H00000204-D01P-2-A0-1.jpg
Application image note: AK2 MaxPab rabbit polyclonal antibody. Western Blot analysis of AK2 expression in human kidney.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy AK2 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart