AK2 MaxPab mouse polyclonal antibody (B01) View larger

AK2 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of AK2 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about AK2 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00000204-B01
Product name: AK2 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human AK2 protein.
Gene id: 204
Gene name: AK2
Gene alias: ADK2
Gene description: adenylate kinase 2
Genbank accession: NM_001625.2
Immunogen: AK2 (NP_001616.1, 1 a.a. ~ 239 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAPSVPAAEPEYPKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHTQTTPLIEYYRKRGIHSAIDASQTPDVVFASILAAFSKATCKDLVMFI
Protein accession: NP_001616.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000204-B01-13-15-1.jpg
Application image note: Western Blot analysis of AK2 expression in transfected 293T cell line (H00000204-T01) by AK2 MaxPab polyclonal antibody.

Lane1:AK2 transfected lysate(26.29 KDa).
Lane2:Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy AK2 MaxPab mouse polyclonal antibody (B01) now

Add to cart