AK1 monoclonal antibody (M09), clone M2 View larger

AK1 monoclonal antibody (M09), clone M2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of AK1 monoclonal antibody (M09), clone M2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about AK1 monoclonal antibody (M09), clone M2

Brand: Abnova
Reference: H00000203-M09
Product name: AK1 monoclonal antibody (M09), clone M2
Product description: Mouse monoclonal antibody raised against a full length recombinant AK1.
Clone: M2
Isotype: IgG1 Kappa
Gene id: 203
Gene name: AK1
Gene alias: -
Gene description: adenylate kinase 1
Genbank accession: BC001116
Immunogen: AK1 (AAH01116, 1 a.a. ~ 194 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MEEKLKKTNIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDALK
Protein accession: AAH01116
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000203-M09-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (47.08 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000203-M09-1-1-1.jpg
Application image note: AK1 monoclonal antibody (M09), clone M2 Western Blot analysis of AK1 expression in HeLa ( Cat # L013V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy AK1 monoclonal antibody (M09), clone M2 now

Add to cart