Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of AHSG monoclonal antibody (M01), clone 5D8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
More info about AHSG monoclonal antibody (M01), clone 5D8
| Brand: | Abnova |
| Reference: | H00000197-M01 |
| Product name: | AHSG monoclonal antibody (M01), clone 5D8 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant AHSG. |
| Clone: | 5D8 |
| Isotype: | IgG2a Kappa |
| Gene id: | 197 |
| Gene name: | AHSG |
| Gene alias: | A2HS|AHS|FETUA|HSGA |
| Gene description: | alpha-2-HS-glycoprotein |
| Genbank accession: | BC048198 |
| Immunogen: | AHSG (AAH48198.1, 19 a.a. ~ 367 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | APHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWPQQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAEDVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVAKEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCTVFQTQPVTSQPQPEGANEAVPTPVVDPDAPPSPPLGAPGLPPAGSPPDSHVLLAAPPGHQLHRAHYDLRHTFMGVVSLGSPSGEVSHPRKTRTVVQPSVGAAAGPVVPPCPGRIRHFKV |
| Protein accession: | AAH48198.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (64.13 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged AHSG is approximately 0.1ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | A proteomics approach to identify changes in protein profiles in serum of Familial Adenomatous Polyposis patients.Quaresima B, Crugliano T, Gaspari M, Faniello MC, Cosimo P, Valanzano R, Genuardi M, Cannataro M, Veltri P, Baudi F, Doldo P, Cuda G, Venuta S, Costanzo F. Cancer Lett. 2008 Dec 8;272(1):40-52. Epub 2008 Jul 29. |