Brand: | Abnova |
Reference: | H00000196-M07 |
Product name: | AHR monoclonal antibody (M07), clone 3B1 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant AHR. |
Clone: | 3B1 |
Isotype: | IgG2b Kappa |
Gene id: | 196 |
Gene name: | AHR |
Gene alias: | bHLHe76 |
Gene description: | aryl hydrocarbon receptor |
Genbank accession: | NM_001621 |
Immunogen: | AHR (NP_001612, 279 a.a. ~ 376 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | EIRTKNFIFRTKHKLDFTPIGCDAKGRIVLGYTEAELCTRGSGYQFIHAADMLYCAESHIRMIKTGESGMIVFRLLTKNNRWTWVQSNARLLYKNGRP |
Protein accession: | NP_001612 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |