AHR monoclonal antibody (M02), clone 3B12 View larger

AHR monoclonal antibody (M02), clone 3B12

H00000196-M02_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of AHR monoclonal antibody (M02), clone 3B12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re,WB-Tr,IP,RNAi-Ab

More info about AHR monoclonal antibody (M02), clone 3B12

Brand: Abnova
Reference: H00000196-M02
Product name: AHR monoclonal antibody (M02), clone 3B12
Product description: Mouse monoclonal antibody raised against a partial recombinant AHR.
Clone: 3B12
Isotype: IgG1 Kappa
Gene id: 196
Gene name: AHR
Gene alias: bHLHe76
Gene description: aryl hydrocarbon receptor
Genbank accession: NM_001621
Immunogen: AHR (NP_001612, 721 a.a. ~ 820 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MGSFEPSPYPTTSSLEDFVTCLQLPENQKHGLNPQSAIITPQTCYAGAVSMYQCQPEPQHTHVGQMQYNPVLPGQQAFLNKFQNGVLNETYPAELNNINN
Protein accession: NP_001612
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000196-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000196-M02-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to AHR on HeLa cell. [antibody concentration 10 ug/ml]
Applications: IF,S-ELISA,ELISA,WB-Re,WB-Tr,IP,RNAi-Ab
Shipping condition: Dry Ice
Publications: Cross-talk between Aryl Hydrocarbon Receptor and the inflammatory response: a Role for NF-κB.Vogel CF, Khan EM, Leung PS, Gershwin ME, Chang WL, Wu D, Haarmann-Stemmann T, Hoffmann A, Denison MS
J Biol Chem. 2014 Jan 17;289(3):1866-75. doi: 10.1074/jbc.M113.505578. Epub 2013 Dec 3.

Reviews

Buy AHR monoclonal antibody (M02), clone 3B12 now

Add to cart