Brand: | Abnova |
Reference: | H00000190-M02 |
Product name: | NR0B1 monoclonal antibody (M02), clone 2F12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant NR0B1. |
Clone: | 2F12 |
Isotype: | IgG2a kappa |
Gene id: | 190 |
Gene name: | NR0B1 |
Gene alias: | AHC|AHCH|AHX|DAX-1|DAX1|DSS|GTD|HHG|NROB1 |
Gene description: | nuclear receptor subfamily 0, group B, member 1 |
Genbank accession: | NM_000475 |
Immunogen: | NR0B1 (NP_000466, 361 a.a. ~ 470 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | IKCFLSKCWSLNISTKEYAYLKGTVLFNPDVPGLQCVKYIQGLQWGTQQILSEHTRMTHQGPHDRFIELNSTLFLLRFINANVIAELFFRPIIGTVSMDDMMLEMLCTKI |
Protein accession: | NP_000466 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged NR0B1 is approximately 1ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA |
Shipping condition: | Dry Ice |