Brand: | Abnova |
Reference: | H00000182-M01A |
Product name: | JAG1 monoclonal antibody (M01A), clone 1E12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant JAG1. |
Clone: | 1E12 |
Isotype: | IgG1 Kappa |
Gene id: | 182 |
Gene name: | JAG1 |
Gene alias: | AGS|AHD|AWS|CD339|HJ1|JAGL1|MGC104644 |
Gene description: | jagged 1 (Alagille syndrome) |
Genbank accession: | NM_000214 |
Immunogen: | JAG1 (NP_000205, 531 a.a. ~ 620 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PNPCQNGAQCYNRASDYFCKCPEDYEGKNCSHLKDHCRTTPCEVIDSCTVAMASNDTPEGVRYISSNVCGPHGKCKSQSGGKFTCDCNKG |
Protein accession: | NP_000205 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.64 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |