JAG1 monoclonal antibody (M01A), clone 1E12 View larger

JAG1 monoclonal antibody (M01A), clone 1E12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of JAG1 monoclonal antibody (M01A), clone 1E12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about JAG1 monoclonal antibody (M01A), clone 1E12

Brand: Abnova
Reference: H00000182-M01A
Product name: JAG1 monoclonal antibody (M01A), clone 1E12
Product description: Mouse monoclonal antibody raised against a partial recombinant JAG1.
Clone: 1E12
Isotype: IgG1 Kappa
Gene id: 182
Gene name: JAG1
Gene alias: AGS|AHD|AWS|CD339|HJ1|JAGL1|MGC104644
Gene description: jagged 1 (Alagille syndrome)
Genbank accession: NM_000214
Immunogen: JAG1 (NP_000205, 531 a.a. ~ 620 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PNPCQNGAQCYNRASDYFCKCPEDYEGKNCSHLKDHCRTTPCEVIDSCTVAMASNDTPEGVRYISSNVCGPHGKCKSQSGGKFTCDCNKG
Protein accession: NP_000205
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000182-M01A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.64 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy JAG1 monoclonal antibody (M01A), clone 1E12 now

Add to cart