Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of AGER monoclonal antibody (M05), clone 1D1
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
More info about AGER monoclonal antibody (M05), clone 1D1
| Brand: | Abnova |
| Reference: | H00000177-M05 |
| Product name: | AGER monoclonal antibody (M05), clone 1D1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant AGER. |
| Clone: | 1D1 |
| Isotype: | IgG2a Kappa |
| Gene id: | 177 |
| Gene name: | AGER |
| Gene alias: | MGC22357|RAGE |
| Gene description: | advanced glycosylation end product-specific receptor |
| Genbank accession: | BC020669 |
| Immunogen: | AGER (AAH20669.1, 87 a.a. ~ 197 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPA |
| Protein accession: | AAH20669.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of AGER expression in transfected 293T cell line by AGER monoclonal antibody (M05), clone 1D1. Lane 1: AGER transfected lysate(42.8 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |