Brand: | Abnova |
Reference: | H00000174-M01 |
Product name: | AFP monoclonal antibody (M01), clone 1G7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant AFP. |
Clone: | 1G7 |
Isotype: | IgG2a Kappa |
Gene id: | 174 |
Gene name: | AFP |
Gene alias: | FETA|HPAFP |
Gene description: | alpha-fetoprotein |
Genbank accession: | BC027881 |
Immunogen: | AFP (AAH27881, 500 a.a. ~ 609 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | CCTSSYANRRPCFSSLVVDETYVPPAFSDDKFIFHKDLCQAQGVALQTMKQEFLINLVKQKPQITEEQLEAVIADFSGLLEKCCQGQEQEVCFAEEGQKLISKTRAALGV |
Protein accession: | AAH27881 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to AFP on HepG2 cell. [antibody concentration 30 ug/ml] |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
Shipping condition: | Dry Ice |
Publications: | A single-step enzyme immunoassay capillary sensor composed of functional multilayer coatings for diagnosis marker proteins.Funano SI, Sugahara M, Henares TG, Sueyoshi K, Endo T, Hisamoto H. Analyst. 2015 Jan 19. |