AES monoclonal antibody (M02), clone 1E1 View larger

AES monoclonal antibody (M02), clone 1E1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of AES monoclonal antibody (M02), clone 1E1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about AES monoclonal antibody (M02), clone 1E1

Brand: Abnova
Reference: H00000166-M02
Product name: AES monoclonal antibody (M02), clone 1E1
Product description: Mouse monoclonal antibody raised against a partial recombinant AES.
Clone: 1E1
Isotype: IgG1 Kappa
Gene id: 166
Gene name: AES
Gene alias: AES-1|AES-2|ESP1|GRG|GRG5|TLE5
Gene description: amino-terminal enhancer of split
Genbank accession: NM_001130
Immunogen: AES (NP_001121, 2 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MFPQSRHSGSSHLPQQLKFTTSDSCDRIKDEFQLLQAQYHSLKLECDKLASEKSEMQRHYVMYYEMSYGLNIEMHKQAEIVKRLNGICAQVLPYLSQEHQQQVLGAIER
Protein accession: NP_001121
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000166-M02-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged AES is approximately 1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy AES monoclonal antibody (M02), clone 1E1 now

Add to cart