Brand: | Abnova |
Reference: | H00000163-M01 |
Product name: | AP2B1 monoclonal antibody (M01), clone 2D5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant AP2B1. |
Clone: | 2D5 |
Isotype: | IgG1 Kappa |
Gene id: | 163 |
Gene name: | AP2B1 |
Gene alias: | ADTB2|AP105B|AP2-BETA|CLAPB1|DKFZp781K0743 |
Gene description: | adaptor-related protein complex 2, beta 1 subunit |
Genbank accession: | NM_001282 |
Immunogen: | AP2B1 (NP_001273.1, 585 a.a. ~ 651 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SHGIHRKHLPIHHGSTDAGDSPVGTTTATNLEQPQVIPSQGDLLGDLLNLDLGPPVNVPQVSSMQMG |
Protein accession: | NP_001273.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (33.11 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to AP2B1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml] |
Applications: | IHC-P,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |