AP2B1 monoclonal antibody (M01), clone 2D5 View larger

AP2B1 monoclonal antibody (M01), clone 2D5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of AP2B1 monoclonal antibody (M01), clone 2D5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,S-ELISA,ELISA,WB-Re

More info about AP2B1 monoclonal antibody (M01), clone 2D5

Brand: Abnova
Reference: H00000163-M01
Product name: AP2B1 monoclonal antibody (M01), clone 2D5
Product description: Mouse monoclonal antibody raised against a partial recombinant AP2B1.
Clone: 2D5
Isotype: IgG1 Kappa
Gene id: 163
Gene name: AP2B1
Gene alias: ADTB2|AP105B|AP2-BETA|CLAPB1|DKFZp781K0743
Gene description: adaptor-related protein complex 2, beta 1 subunit
Genbank accession: NM_001282
Immunogen: AP2B1 (NP_001273.1, 585 a.a. ~ 651 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SHGIHRKHLPIHHGSTDAGDSPVGTTTATNLEQPQVIPSQGDLLGDLLNLDLGPPVNVPQVSSMQMG
Protein accession: NP_001273.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000163-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (33.11 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000163-M01-3-41-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to AP2B1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]
Applications: IHC-P,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy AP2B1 monoclonal antibody (M01), clone 2D5 now

Add to cart