PARP1 monoclonal antibody (M01), clone 3G4 View larger

PARP1 monoclonal antibody (M01), clone 3G4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PARP1 monoclonal antibody (M01), clone 3G4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,S-ELISA,ELISA,WB-Re

More info about PARP1 monoclonal antibody (M01), clone 3G4

Brand: Abnova
Reference: H00000142-M01
Product name: PARP1 monoclonal antibody (M01), clone 3G4
Product description: Mouse monoclonal antibody raised against a partial recombinant PARP1.
Clone: 3G4
Isotype: IgG2a Kappa
Gene id: 142
Gene name: PARP1
Gene alias: ADPRT|ADPRT1|PARP|PARP-1|PPOL|pADPRT-1
Gene description: poly (ADP-ribose) polymerase 1
Genbank accession: BC037545
Immunogen: PARP1 (AAH37545, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAESSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHSIRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQD
Protein accession: AAH37545
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000142-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000142-M01-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to PARP1 on HeLa cell. [antibody concentration 10 ug/ml]
Applications: WB-Ce,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: The Metastasis Efficiency Modifier Ribosomal RNA Processing 1 Homolog B (RRP1B) Is a Chromatin-associated Factor.Crawford NP, Yang H, Mattaini KR, Hunter KW.
J Biol Chem. 2009 Oct 16;284(42):28660-73. Epub 2009 Aug 26.

Reviews

Buy PARP1 monoclonal antibody (M01), clone 3G4 now

Add to cart